General Information

  • ID:  hor002777
  • Uniprot ID:  P63312
  • Protein name:  TYB10 30-44
  • Gene name:  Tmsb10
  • Organism:  Rattus norvegicus (Rat)
  • Family:  Thymosin beta family
  • Source:  Animal
  • Expression:  Found to decrease dramatically after birth.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Rattus (genus), Murinae (subfamily), Muridae (family), Muroidea, Myomorpha (suborder), Rodentia (order), Glires, Euarchontoglires (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0003779 actin binding; GO:0003785 actin monomer binding
  • GO BP:  GO:0007015 actin filament organization; GO:0007286 spermatid development; GO:0030036 actin cytoskeleton organization; GO:0030334 regulation of cell migration; GO:0042989 sequestering of actin monomers
  • GO CC:  GO:0005737 cytoplasm; GO:0005856 cytoskeleton

Sequence Information

  • Sequence:  PTKETIEQEKRSEIS
  • Length:  15(30-44)
  • Propeptide:  MADKPDMGEIASFDKAKLKKTETQEKNTLPTKETIEQEKRSEIS
  • Signal peptide:  NA
  • Modification:  T5 Phosphothreonine;T10 N6-acetyllysine;T12 Phosphoserine
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Plays an important role in the organization of the cytoskeleton. Binds to and sequesters actin monomers (G actin) and therefore inhibits actin polymerization (By similarity).
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P63312-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor002777_AF2.pdbhor002777_ESM.pdb

Physical Information

Mass: 202482 Formula: C74H127N21O29
Absent amino acids: ACDFGHLMNVWY Common amino acids: E
pI: 4.63 Basic residues: 3
Polar residues: 4 Hydrophobic residues: 2
Hydrophobicity: -169.33 Boman Index: -6090
Half-Life: >20 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: ? Aliphatic Index 52
Instability Index: 14101.33 Extinction Coefficient cystines: 0
Absorbance 280nm: 0

Literature

  • PubMed ID:  23410195
  • Title:  Neurotoxin-Induced Neuropeptide Perturbations in Striatum of Neonatal Rats